PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0080000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 27145.8 Da    PI: 9.2175
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0080000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvtf+kRrng++KKA+ELS+LC+ae+a+i+fss+g+lyeyss
  Spipo4G0080000  9 KRIENTTNRQVTFCKRRNGLMKKAYELSILCEAEIALIVFSSRGRLYEYSS 59
                    79***********************************************96 PP

2K-box1041.9e-34831749100
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +e ++++++qqe+ kL+++i++Lq+++Rhl+Ge L+sL++keL+qLe++Le+++ ++RskK+ell+++ie++qk+e el++e + Lr+kl+e
  Spipo4G0080000  83 TEVKTQQHYQQEAGKLRQQIQMLQNSNRHLMGEHLDSLNVKELKQLENRLERGIARVRSKKQELLFAEIEYMQKRELELENESMFLRSKLAE 174
                     667889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.6E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.109161IPR002100Transcription factor, MADS-box
CDDcd002651.05E-41277No hitNo description
SuperFamilySSF554553.4E-31282IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.5E-2784172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.9188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLMK KAYELSILCE AEIALIVFSS RGRLYEYSSC  60
GNIYTTIDRY KKSHSASNPG AITEVKTQQH YQQEAGKLRQ QIQMLQNSNR HLMGEHLDSL  120
NVKELKQLEN RLERGIARVR SKKQELLFAE IEYMQKRELE LENESMFLRS KLAESERSHQ  180
LVQAGPEFEG LPGFDPRSYY HPLQMFDPSQ HYPTHQDQTA LQLGYEMKSN PSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-20169164Myocyte-specific enhancer factor 2B
1tqe_R1e-20169164Myocyte-specific enhancer factor 2B
1tqe_Q1e-20169164Myocyte-specific enhancer factor 2B
1tqe_P1e-20169164Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908080.11e-119PREDICTED: MADS-box transcription factor 21-like
SwissprotQ8RU312e-93MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A076YHP61e-120A0A076YHP6_COCNU; AGAMOUS-like MADS-box protein
STRINGGSMUA_Achr5P16870_0011e-114(Musa acuminata)
STRINGGSMUA_Achr7P23690_0011e-114(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.16e-90MIKC_MADS family protein